Lineage for d4iwna_ (4iwn A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.14: Hypothetical protein HI0319 (YecO) [69544] (2 proteins) Protein automated matches [197190] (2 species)
not a true proteinSpecies Escherichia coli [TaxId:562] [197191] (1 PDB entry) 
Domain d4iwna_: 4iwn A: [197250]
automated match to d1im8a_
protein/RNA complex; complexed with gek, mpd
Details for d4iwna_
PDB Entry: 4iwn (more details), 1.73 Å
PDB Description: Crystal structure of a putative methyltransferase CmoA in complex with a novel SAM derivative
PDB Compounds: (A:) tRNA (cmo5U34)-methyltransferaseSCOPe Domain Sequences for d4iwna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iwna_ c.66.1.14 (A:) automated matches {Escherichia coli [TaxId: 562]}
tfdervaevfpdmiqrsvpgysniismigmlaerfvqpgtqvydlgcslgaatlsvrrni
hhdnckiiaidnspamiercrhhidaykaptpvdviegdirdiaienasmvvlnftlqfl
epserqalldkiyqglnpggalvlsekfsfedakvgellfnmhhdfkrangyseleisqk
rsmlenvmltdsvethkarlhnagfehselwfqcfnfgslvalkaedaa
SCOPe Domain Coordinates for d4iwna_:
Click to download the PDB-style file with coordinates for d4iwna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4iwna_:
- d4iwna_ first appeared in SCOPe 2.02
- d4iwna_ appears in SCOPe 2.07
View in 3D
