![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.14: Hypothetical protein HI0319 (YecO) [69544] (2 proteins) |
![]() | Protein automated matches [197190] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [197191] (1 PDB entry) |
![]() | Domain d4iwna_: 4iwn A: [197250] automated match to d1im8a_ protein/RNA complex; complexed with gek, mpd |
PDB Entry: 4iwn (more details), 1.73 Å
SCOPe Domain Sequences for d4iwna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iwna_ c.66.1.14 (A:) automated matches {Escherichia coli [TaxId: 562]} tfdervaevfpdmiqrsvpgysniismigmlaerfvqpgtqvydlgcslgaatlsvrrni hhdnckiiaidnspamiercrhhidaykaptpvdviegdirdiaienasmvvlnftlqfl epserqalldkiyqglnpggalvlsekfsfedakvgellfnmhhdfkrangyseleisqk rsmlenvmltdsvethkarlhnagfehselwfqcfnfgslvalkaedaa
Timeline for d4iwna_: