Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (14 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [236409] (2 PDB entries) |
Domain d4itka_: 4itk A: [236410] automated match to d3ab5a_ complexed with fes, gol |
PDB Entry: 4itk (more details), 1.18 Å
SCOPe Domain Sequences for d4itka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4itka_ d.15.4.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mfkvtfktpkgektidveadkylldaaeeagmdlpyscrsggcstccgklesgtvdqsdq nmldedqlkqgfvltcvayptsdiviltdqesklpiggsenlyf
Timeline for d4itka_: