Lineage for d4itka_ (4itk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894403Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 1894404Protein automated matches [191164] (14 species)
    not a true protein
  7. 1894425Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [236409] (2 PDB entries)
  8. 1894426Domain d4itka_: 4itk A: [236410]
    automated match to d3ab5a_
    complexed with fes, gol

Details for d4itka_

PDB Entry: 4itk (more details), 1.18 Å

PDB Description: the structure of c.reinhardtii ferredoxin 2
PDB Compounds: (A:) Apoferredoxin

SCOPe Domain Sequences for d4itka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4itka_ d.15.4.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mfkvtfktpkgektidveadkylldaaeeagmdlpyscrsggcstccgklesgtvdqsdq
nmldedqlkqgfvltcvayptsdiviltdqesklpiggsenlyf

SCOPe Domain Coordinates for d4itka_:

Click to download the PDB-style file with coordinates for d4itka_.
(The format of our PDB-style files is described here.)

Timeline for d4itka_: