Lineage for d4itjb_ (4itj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (36 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. 2984977Domain d4itjb_: 4itj B: [234904]
    automated match to d4gt5a_
    complexed with 1hx, iod

Details for d4itjb_

PDB Entry: 4itj (more details), 1.8 Å

PDB Description: Crystal structure of RIP1 kinase in complex with necrostatin-4
PDB Compounds: (B:) Receptor-interacting serine/threonine-protein kinase 1

SCOPe Domain Sequences for d4itjb_:

Sequence, based on SEQRES records: (download)

>d4itjb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnvikmkssdflesaeldsggfgkvslafhrtqglmimktvykgpnciehnealleeakm
mnrlrhsrvvkllgviieegkyslvmeymekgnlmhvlkaemstplsvkgriileiiegm
aylhgkgvihkdlkpenilvdndfhikiadlglasfkmwsklnneehnelrevdgtakkn
ggtlyymapehlndvnakpteksdvysfavvlwaifankepyenaiaeqqlimaiksgnr
pdvdditeycpreiislmklcweanpearptfpgieekfrpfylsqle

Sequence, based on observed residues (ATOM records): (download)

>d4itjb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnvikmkssdflesaeldsggfgkvslafhrtqglmimktvykgpnciehnealleeakm
mnrlrhsrvvkllgviieegkyslvmeymekgnlmhvlkaemstplsvkgriileiiegm
aylhgkgvihkdlkpenilvdndfhikiadlglasfkmwsklnneehneltlyymapehl
ndvnakpteksdvysfavvlwaifankepyenaiaeqqlimaiksgnrpdvdditeycpr
eiislmklcweanpearptfpgieekfrpfylsqle

SCOPe Domain Coordinates for d4itjb_:

Click to download the PDB-style file with coordinates for d4itjb_.
(The format of our PDB-style files is described here.)

Timeline for d4itjb_: