SCOPe 2.04: Domain d4irnf2: 4irn F:231-381

Lineage for d4irnf2 (4irn F:231-381)

Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds)
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
Family a.29.3.0: automated matches [227204] (1 protein)
not a true family
Protein automated matches [226935] (18 species)
not a true protein
Species Oscillatoria sp. [TaxId:272129] [229251] (1 PDB entry)
Domain d4irnf2: 4irn F:231-381 [229252]
Other proteins in same PDB: d4irna1, d4irnb1, d4irnc1, d4irnd1, d4irne1, d4irnf1, d4irng1, d4irnh1
automated match to d1ukwa1
complexed with fad

Details for d4irnf2

PDB Entry: 4irn (more details), 2.8 Å

PDB Description: Crystal Structure of the Prolyl Acyl Carrier Protein Oxidase AnaB

PDB Compounds: (F:) Prolyl-ACP dehydrogenase

SCOPe Domain Sequences for d4irnf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irnf2 a.29.3.0 (F:231-381) automated matches {Oscillatoria sp. [TaxId: 272129]}
gtglaifnhsmewergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvem
klrlenakaylykvawmkenkqmalleasmanlyiseawvqscleaieihgaygyltnte
lerelrdaiaskfysgtseiqrvviakflgl

SCOPe Domain Coordinates for d4irnf2:

Click to download the PDB-style file with coordinates for d4irnf2.
(The format of our PDB-style files is described here.)

Timeline for d4irnf2: