Class a: All alpha proteins [46456] (284 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (15 species) not a true protein |
Species Oscillatoria sp. [TaxId:272129] [229251] (1 PDB entry) |
Domain d4irnf2: 4irn F:231-381 [229252] Other proteins in same PDB: d4irnf1 automated match to d1ukwa1 complexed with fad |
PDB Entry: 4irn (more details), 2.8 Å
SCOPe Domain Sequences for d4irnf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irnf2 a.29.3.0 (F:231-381) automated matches {Oscillatoria sp. [TaxId: 272129]} gtglaifnhsmewergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvem klrlenakaylykvawmkenkqmalleasmanlyiseawvqscleaieihgaygyltnte lerelrdaiaskfysgtseiqrvviakflgl
Timeline for d4irnf2: