Lineage for d4iq1a1 (4iq1 A:0-80)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1603003Species Mannheimia haemolytica [TaxId:272629] [226567] (2 PDB entries)
  8. 1603007Domain d4iq1a1: 4iq1 A:0-80 [223296]
    Other proteins in same PDB: d4iq1a2, d4iq1b2, d4iq1c2
    automated match to d2pmta2
    complexed with cl, gol

Details for d4iq1a1

PDB Entry: 4iq1 (more details), 1.85 Å

PDB Description: crystal structure of glutathione s-transferase mha_0454 (target efi-507015) from mannheimia haemolytica, substrate-free
PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d4iq1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iq1a1 c.47.1.0 (A:0-80) automated matches {Mannheimia haemolytica [TaxId: 272629]}
smklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvpllvdg
dlaltqnqaivhyldelypea

SCOPe Domain Coordinates for d4iq1a1:

Click to download the PDB-style file with coordinates for d4iq1a1.
(The format of our PDB-style files is described here.)

Timeline for d4iq1a1: