Lineage for d4incb_ (4inc B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.13: HIT-like [54196] (2 superfamilies)
alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alphaSuperfamily d.13.1: HIT-like [54197] (6 families) 
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
Pfam PF01230
topologically similar to the N-terminal domain of protein kinases
Protein automated matches [191082] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189791] (32 PDB entries) 
Domain d4incb_: 4inc B: [193096]
automated match to d3tw2a_
complexed with cl
Details for d4incb_
PDB Entry: 4inc (more details), 1.19 Å
PDB Description: Human Histidine Triad Nucleotide Binding Protein 2
PDB Compounds: (B:) Histidine triad nucleotide-binding protein 2, mitochondrialSCOPe Domain Sequences for d4incb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4incb_ d.13.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aptifsrildkslpadilyedqqclvfrdvapqapvhflvipkkpiprisqaeeedqqll
ghlllvakqtakaeglgdgyrlvindgklgaqsvyhlhihvlggrqlqwppg
SCOPe Domain Coordinates for d4incb_:
Click to download the PDB-style file with coordinates for d4incb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4incb_:
- d4incb_ first appeared in SCOPe 2.02
- d4incb_ appears in SCOPe 2.07
View in 3D
