![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.11: Kelch motif [117281] (2 families) ![]() |
![]() | Family b.68.11.1: Kelch motif [117282] (2 proteins) Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967) |
![]() | Protein automated matches [190126] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [193097] (11 PDB entries) |
![]() | Domain d4in4c_: 4in4 C: [202620] automated match to d4in4a_ complexed with 4id, po4 |
PDB Entry: 4in4 (more details), 2.59 Å
SCOPe Domain Sequences for d4in4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4in4c_ b.68.11.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggr nnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsv eryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmi tamntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgit vhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
Timeline for d4in4c_: