SCOPe 2.05: Domain d4imyb2: 4imy B:151-257

Lineage for d4imyb2 (4imy B:151-257)

Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds)
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the others
Superfamily a.74.1: Cyclin-like [47954] (4 families)
duplication: consists of two domains of this fold
Family a.74.1.1: Cyclin [47955] (9 proteins)
Protein Cyclin T1 [158595] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
Domain d4imyb2: 4imy B:151-257 [234885]
Other proteins in same PDB: d4imya_, d4imyc_, d4imye_
automated match to d2pk2a1
complexed with amp

Details for d4imyb2

PDB Entry: 4imy (more details), 2.94 Å

PDB Description: The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat

PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d4imyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4imyb2 a.74.1.1 (B:151-257) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwn

SCOPe Domain Coordinates for d4imyb2:

Click to download the PDB-style file with coordinates for d4imyb2.
(The format of our PDB-style files is described here.)

Timeline for d4imyb2: