Lineage for d4ikwa_ (4ikw A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028261Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar
  4. 3028262Superfamily f.38.1: MFS general substrate transporter [103473] (5 families) (S)
  5. 3028282Family f.38.1.3: Proton-dependent oligopeptide transporter (POT or PTR2) / nitrate transporter NRT1 family [310629] (2 proteins)
    Pfam PF00854; microbial members have 2 additional helices between H6 and H7
  6. 3028283Protein Microbial PepT or POT [310739] (3 species)
  7. 3028284Species Geobacillus kaustophilus [TaxId:1462] [310992] (5 PDB entries)
  8. 3028286Domain d4ikwa_: 4ikw A: [307539]
    automated match to d4ikza_
    complexed with ola, olc, pg4, so4

Details for d4ikwa_

PDB Entry: 4ikw (more details), 2 Å

PDB Description: crystal structure of peptide transporter pot in complex with sulfate
PDB Compounds: (A:) Di-tripeptide ABC transporter (Permease)

SCOPe Domain Sequences for d4ikwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ikwa_ f.38.1.3 (A:) Microbial PepT or POT {Geobacillus kaustophilus [TaxId: 1462]}
asidkqqiaasvpqrgffghpkglftlfftefwerfsyygmrailvyymyyevskgglgl
dehlalaimsiygalvymsgiiggwladrvfgtsravfyggllimaghialaipggvaal
fvsmalivlgtgllkpnvssivgdmykpgddrrdagfsifymginlgaflaplvvgtagm
kynfhlgfglaavgmflglvvfvatrkknlglagtyvpnpltpaekkkaaaimavgavvi
avllailipngwftvetfislvgilgiiipiiyfvvmyrspkttaeersrviayiplfva
samfwaiqeqgstilanyadkrtqldvagihlspawfqslnplfiiilapvfawmwvklg
krqptipqkfalgllfaglsfivilvpghlsggglvhpiwlvlsyfivvlgelclspvgl
sattklapaafsaqtmslwflsnaaaqainaqlvrfytpenetayfgtiggaalvlglil
laiaprigrlmkg

SCOPe Domain Coordinates for d4ikwa_:

Click to download the PDB-style file with coordinates for d4ikwa_.
(The format of our PDB-style files is described here.)

Timeline for d4ikwa_: