Lineage for d4ii2b_ (4ii2 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) 
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
Pfam PF00240
Protein automated matches [190118] (9 species)
not a true protein
Species Schizosaccharomyces pombe [TaxId:284812] [196615] (2 PDB entries) 
Domain d4ii2b_: 4ii2 B: [196616]
Other proteins in same PDB: d4ii2c_
automated match to d3cmmb_
complexed with atp, edo, mg, pg0, so4
Details for d4ii2b_
PDB Entry: 4ii2 (more details), 2.2 Å
PDB Description: crystal structure of ubiquitin activating enzyme 1 (uba1) in complex with the ub e2 ubc4, ubiquitin, and atp/mg
PDB Compounds: (B:) ubiquitin-60s ribosomal protein l40SCOPe Domain Sequences for d4ii2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ii2b_ d.15.1.1 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
hhhhmqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledgrtl
adyniqrestlhlvlrlrgg
SCOPe Domain Coordinates for d4ii2b_:
Click to download the PDB-style file with coordinates for d4ii2b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ii2b_:
- d4ii2b_ first appeared in SCOPe 2.02
- d4ii2b_ appears in SCOPe 2.04
- d4ii2b_ is called d4ii2b1 in SCOPe 2.06
- d4ii2b_ appears in the current release, SCOPe 2.08, called d4ii2b1
View in 3D
