Lineage for d4ihja1 (4ihj A:1-245)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843745Protein automated matches [226837] (6 species)
    not a true protein
  7. 1843746Species Cow (Bos taurus) [TaxId:9913] [226564] (16 PDB entries)
  8. 1843747Domain d4ihja1: 4ihj A:1-245 [202610]
    Other proteins in same PDB: d4ihja2, d4ihjb2, d4ihjc2, d4ihjd2, d4ihje_
    automated match to d1tuba1
    complexed with adp, ca, cl, gdp, gol, gtp, mes, mg

Details for d4ihja1

PDB Entry: 4ihj (more details), 2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-adp complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4ihja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ihja1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d4ihja1:

Click to download the PDB-style file with coordinates for d4ihja1.
(The format of our PDB-style files is described here.)

Timeline for d4ihja1: