Lineage for d4ih1a_ (4ih1 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. Protein automated matches [190543] (128 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries)
  8. Domain d4ih1a_: 4ih1 A: [252623]
    automated match to d1woma_

Details for d4ih1a_

PDB Entry: 4ih1 (more details), 1.55 Å

PDB Description: Crystal structure of Karrikin Insensitive 2 (KAI2) from Arabidopsis thaliana
PDB Compounds: (A:) Hydrolase, alpha/beta fold family protein

SCOPe Domain Sequences for d4ih1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ih1a_ c.69.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpd
yfdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisa
spryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfn
mrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvev
ipsdghlpqlsspdsvipvilrhirndi

SCOPe Domain Coordinates for d4ih1a_ are not available.

Timeline for d4ih1a_: