Lineage for d4iena_ (4ien A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944491Species Neisseria meningitidis [TaxId:272831] [193287] (8 PDB entries)
  8. 2944500Domain d4iena_: 4ien A: [202607]
    automated match to d4iend_
    complexed with cl, coa, gdp

Details for d4iena_

PDB Entry: 4ien (more details), 2 Å

PDB Description: crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18
PDB Compounds: (A:) Putative acyl-CoA hydrolase

SCOPe Domain Sequences for d4iena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iena_ d.38.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 272831]}
rqlpshelimselmmpdtanfsgnvhggellllldqvayscasrysgnycvtlsvdkvlf
kepihigdlvtfyaavnytgrtsmeigirveaqnirtgeirhtnscyftmvavkdgkpvp
vppleiltdrqrcryekakkrrdislqasedmsc

SCOPe Domain Coordinates for d4iena_:

Click to download the PDB-style file with coordinates for d4iena_.
(The format of our PDB-style files is described here.)

Timeline for d4iena_: