Lineage for d4i8ba_ (4i8b A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.0: automated matches [191312] (1 protein)
not a true familyProtein automated matches [190056] (195 species)
not a true protein
Species Schistosoma japonicum [TaxId:6182] [225614] (9 PDB entries) 
Domain d4i8ba_: 4i8b A: [229407]
automated match to d1ti3a_
Details for d4i8ba_
PDB Entry: 4i8b (more details), 2 Å
PDB Description: crystal structure of thioredoxin from schistosoma japonicum
PDB Compounds: (A:) thioredoxinSCOPe Domain Sequences for d4i8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i8ba_ c.47.1.0 (A:) automated matches {Schistosoma japonicum [TaxId: 6182]}
snvlhietdddfdsflkenkdklivvdffatwcgpckkiapafealsadrsalyvkvdvd
kleetarkydvsamptfivikngekvdtvvgasienveaairkhk
SCOPe Domain Coordinates for d4i8ba_:
Click to download the PDB-style file with coordinates for d4i8ba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i8ba_:
- d4i8ba_ first appeared in SCOPe 2.03
- d4i8ba_ appears in SCOPe 2.07
View in 3D
