Lineage for d4i7hb_ (4i7h B:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) 
contains a small beta-sheet (wing)
Family a.4.5.0: automated matches [191329] (1 protein)
not a true familyProtein automated matches [190154] (52 species)
not a true protein
Species Streptococcus pyogenes [TaxId:198466] [193090] (2 PDB entries) 
Domain d4i7hb_: 4i7h B: [193091]
automated match to d2xigc_
complexed with ni, zn
Details for d4i7hb_
PDB Entry: 4i7h (more details), 2 Å
PDB Description: structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes
PDB Compounds: (B:) peroxide stress sensing regulatorSCOPe Domain Sequences for d4i7hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7hb_ a.4.5.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 198466]}
dihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpnm
slatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmdi
akeaheqtgykvtripviaygicpdcqa
SCOPe Domain Coordinates for d4i7hb_:
Click to download the PDB-style file with coordinates for d4i7hb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i7hb_:
- d4i7hb_ first appeared in SCOPe 2.02
- d4i7hb_ appears in SCOPe 2.03
- d4i7hb_ appears in SCOPe 2.05
- d4i7hb_ appears in the current release, SCOPe 2.08
View in 3D
