Lineage for d4i6la_ (4i6l A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (23 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheetFamily d.3.1.0: automated matches [191342] (1 protein)
not a true familyProtein automated matches [190230] (16 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries) 
Domain d4i6la_: 4i6l A: [194133]
Other proteins in same PDB: d4i6lb_
automated match to d2zfya_
Details for d4i6la_
PDB Entry: 4i6l (more details), 2.49 Å
PDB Description: Crystal structure of OTUB1 in complex with ubiquitin variant
PDB Compounds: (A:) Ubiquitin thioesterase OTUB1SCOPe Domain Sequences for d4i6la_:
Sequence, based on SEQRES records: (download)
>d4i6la_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsnplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgnsfyrafgfshle
allddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasf
ndqstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiia
laqalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk
Sequence, based on observed residues (ATOM records): (download)
>d4i6la_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsnplvserlelsvlykeydniyqqkikdlhkkysyirktrpdgnsfyrafgfshleall
ddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndq
stsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaq
alsvsiqveymphifpegsepkvyllyrpghydilyk
SCOPe Domain Coordinates for d4i6la_:
Click to download the PDB-style file with coordinates for d4i6la_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i6la_:
- d4i6la_ first appeared in SCOPe 2.02
- d4i6la_ appears in SCOPe 2.03
- d4i6la_ appears in SCOPe 2.05
- d4i6la_ appears in the current release, SCOPe 2.08, called d4i6la1
View in 3D
