Lineage for d4i6jc2 (4i6j C:85-162)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
multihelical; interlocked heterodimer with F-box proteinsSuperfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) 
automatically mapped to Pfam PF01466
Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) 
Protein automated matches [226933] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [225235] (6 PDB entries) 
Domain d4i6jc2: 4i6j C:85-162 [222960]
Other proteins in same PDB: d4i6ja1, d4i6jc1
automated match to d1p22b1
Details for d4i6jc2
PDB Entry: 4i6j (more details), 2.7 Å
PDB Description: A ubiquitin ligase-substrate complex
PDB Compounds: (C:) S-phase kinase-associated protein 1SCOPe Domain Sequences for d4i6jc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i6jc2 a.157.1.1 (C:85-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwcee
SCOPe Domain Coordinates for d4i6jc2:
Click to download the PDB-style file with coordinates for d4i6jc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i6jc2:
- d4i6jc2 first appeared in SCOPe 2.03
- d4i6jc2 appears in SCOPe 2.05
- d4i6jc2 appears in SCOPe 2.07
- d4i6jc2 appears in the current release, SCOPe 2.08
View in 3D
