Lineage for d4i60a_ (4i60 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1801148Protein automated matches [190191] (2 species)
    not a true protein
  7. 1801149Species Chicken (Gallus gallus) [TaxId:9031] [186931] (25 PDB entries)
  8. 1801204Domain d4i60a_: 4i60 A: [222948]
    automated match to d1wbia_
    complexed with b1r

Details for d4i60a_

PDB Entry: 4i60 (more details), 2.5 Å

PDB Description: crystal structure of avidin - biotinylruthenocene complex
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d4i60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i60a_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnskgeftgtyttavtatsneikesplhgtqntinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trlrtqke

SCOPe Domain Coordinates for d4i60a_:

Click to download the PDB-style file with coordinates for d4i60a_.
(The format of our PDB-style files is described here.)

Timeline for d4i60a_: