Lineage for d4i5ea_ (4i5e A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351030Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries)
  8. 1351059Domain d4i5ea_: 4i5e A: [197316]
    automated match to d3vc7a_
    complexed with gol, nap

Details for d4i5ea_

PDB Entry: 4i5e (more details), 2.8 Å

PDB Description: Crystal structure of Ralstonia sp. alcohol dehydrogenase in complex with NADP+
PDB Compounds: (A:) Alclohol dehydrogenase/short-chain dehydrogenase

SCOPe Domain Sequences for d4i5ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5ea_ c.2.1.0 (A:) automated matches {Ralstonia sp. [TaxId: 517192]}
ayrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad
vtkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvq
kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp
gaidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagiel
fvdggltqv

SCOPe Domain Coordinates for d4i5ea_:

Click to download the PDB-style file with coordinates for d4i5ea_.
(The format of our PDB-style files is described here.)

Timeline for d4i5ea_: