Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
Domain d4i5bd1: 4i5b D:2-81 [229424] Other proteins in same PDB: d4i5ba2, d4i5bb1, d4i5bb2, d4i5bd2, d4i5be1, d4i5be2 automated match to d1aqda2 |
PDB Entry: 4i5b (more details), 2.12 Å
SCOPe Domain Sequences for d4i5bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5bd1 d.19.1.1 (D:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala niacdkanleimtkrsnytp
Timeline for d4i5bd1: