Lineage for d4i5bd1 (4i5b D:2-81)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545290Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2545300Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 2545315Domain d4i5bd1: 4i5b D:2-81 [229424]
    Other proteins in same PDB: d4i5ba2, d4i5bb1, d4i5bb2, d4i5bd2, d4i5be1, d4i5be2
    automated match to d1aqda2

Details for d4i5bd1

PDB Entry: 4i5b (more details), 2.12 Å

PDB Description: structure of human mhc class ii protein hla-dr1 carrying an influenza hemagglutinin peptide partially filling the binding groove
PDB Compounds: (D:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4i5bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5bd1 d.19.1.1 (D:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niacdkanleimtkrsnytp

SCOPe Domain Coordinates for d4i5bd1:

Click to download the PDB-style file with coordinates for d4i5bd1.
(The format of our PDB-style files is described here.)

Timeline for d4i5bd1:

2545315
d4i5bd1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4i5bd2