Lineage for d4i50a2 (4i50 A:246-438)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2565863Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)
  8. 2566242Domain d4i50a2: 4i50 A:246-438 [222915]
    Other proteins in same PDB: d4i50a1, d4i50b1, d4i50c1, d4i50d1, d4i50e_, d4i50f1, d4i50f2, d4i50f3
    automated match to d1z2ba2
    complexed with acp, ca, cl, ep, gdp, gol, gtp, mes, mg

Details for d4i50a2

PDB Entry: 4i50 (more details), 2.3 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-epothilone a complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4i50a2:

Sequence, based on SEQRES records: (download)

>d4i50a2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

Sequence, based on observed residues (ATOM records): (download)

>d4i50a2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekheqlsvaeitnacfepanqmvkcdp
rhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggd
lakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaa
lekdyeevgvd

SCOPe Domain Coordinates for d4i50a2:

Click to download the PDB-style file with coordinates for d4i50a2.
(The format of our PDB-style files is described here.)

Timeline for d4i50a2: