Lineage for d4i2ua_ (4i2u A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370340Species Chlorella sorokiniana [TaxId:3076] [229236] (2 PDB entries)
  8. 1370341Domain d4i2ua_: 4i2u A: [229237]
    automated match to d1jhba_
    complexed with gsh

Details for d4i2ua_

PDB Entry: 4i2u (more details), 1.3 Å

PDB Description: Crystal structure of the reduced glutaredoxin from Chlorella sorokiniana T-89 in complex with glutathione
PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d4i2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2ua_ c.47.1.0 (A:) automated matches {Chlorella sorokiniana [TaxId: 3076]}
saakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqdy
lleltggrsvprvfidgqfigggddtdalarngklevmlrnagvllehh

SCOPe Domain Coordinates for d4i2ua_:

Click to download the PDB-style file with coordinates for d4i2ua_.
(The format of our PDB-style files is described here.)

Timeline for d4i2ua_: