Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (27 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries) |
Domain d4i1og_: 4i1o G: [194137] automated match to d3nkva_ complexed with bef, gdp, mg, peg |
PDB Entry: 4i1o (more details), 2.7 Å
SCOPe Domain Sequences for d4i1og_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i1og_ c.37.1.8 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlfq
Timeline for d4i1og_: