Lineage for d4i0aa1 (4i0a A:8-138)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027Protein automated matches [190352] (8 species)
not a true protein
Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries) 
Domain d4i0aa1: 4i0a A:8-138 [228640]
Other proteins in same PDB: d4i0aa2, d4i0ab2
automated match to d1hw5a2
complexed with cmp, gol; mutant
Details for d4i0aa1
PDB Entry: 4i0a (more details), 2.2 Å
PDB Description: structure of the mutant Catabolite gene activator protein V132A
PDB Compounds: (A:) Catabolite gene activatorSCOPe Domain Sequences for d4i0aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i0aa1 b.82.3.2 (A:8-138) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
tsekagnlafl
SCOPe Domain Coordinates for d4i0aa1:
Click to download the PDB-style file with coordinates for d4i0aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i0aa1:
- d4i0aa1 first appeared in SCOPe 2.03
- d4i0aa1 appears in SCOPe 2.05
- d4i0aa1 appears in SCOPe 2.07
- d4i0aa1 appears in the current release, SCOPe 2.08
View in 3D
