| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
| Protein automated matches [190182] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries) |
| Domain d4i03a_: 4i03 A: [196935] automated match to d1os9a_ complexed with ca, dms, edo, gol, l88, peg, pgo, zn |
PDB Entry: 4i03 (more details), 1.7 Å
SCOPe Domain Sequences for d4i03a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i03a_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg
Timeline for d4i03a_: