SCOPe 2.07: Domain d4i02e1: 4i02 E:9-138

Lineage for d4i02e1 (4i02 E:9-138)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)

Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology

Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein automated matches [190352] (9 species)
not a true protein
Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries)
Domain d4i02e1: 4i02 E:9-138 [228638]
Other proteins in same PDB: d4i02a2, d4i02b2, d4i02c2, d4i02d2, d4i02e2, d4i02f2
automated match to d1hw5a2
complexed with cmp; mutant

Details for d4i02e1

PDB Entry: 4i02 (more details), 1.75 Å

PDB Description: structure of the mutant Catabolite gene activator protein V140A

PDB Compounds: (E:) Catabolite gene activator

SCOPe Domain Sequences for d4i02e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i02e1 b.82.3.2 (E:9-138) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

SCOPe Domain Coordinates for d4i02e1:

Click to download the PDB-style file with coordinates for d4i02e1.
(The format of our PDB-style files is described here.)

Timeline for d4i02e1: