Lineage for d4hx3k_ (4hx3 K:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1660636Family d.92.1.1: Zinc protease [55487] (2 proteins)
    single domain
    automatically mapped to Pfam PF02031
  6. 1660641Protein automated matches [194246] (1 species)
    not a true protein
  7. 1660642Species Streptomyces caespitosus [TaxId:53502] [194247] (1 PDB entry)
  8. 1660648Domain d4hx3k_: 4hx3 K: [194248]
    Other proteins in same PDB: d4hx3b_, d4hx3d_, d4hx3f_, d4hx3h_, d4hx3j_, d4hx3l_
    automated match to d1c7ka_
    complexed with gol, zn

Details for d4hx3k_

PDB Entry: 4hx3 (more details), 2.7 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin
PDB Compounds: (K:) Extracellular small neutral protease

SCOPe Domain Sequences for d4hx3k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hx3k_ d.92.1.1 (K:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
pmvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdg
hgrgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypna
qersrvnalwang

SCOPe Domain Coordinates for d4hx3k_:

Click to download the PDB-style file with coordinates for d4hx3k_.
(The format of our PDB-style files is described here.)

Timeline for d4hx3k_: