Lineage for d4hwra1 (4hwr A:242-532)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574233Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2574459Protein automated matches [193659] (7 species)
    not a true protein
  7. 2574474Species Escherichia coli K-12 [TaxId:83333] [227935] (6 PDB entries)
  8. 2574481Domain d4hwra1: 4hwr A:242-532 [234711]
    Other proteins in same PDB: d4hwra2, d4hwra3, d4hwra4
    automated match to d4hwpb1
    protein/RNA complex; complexed with 1b2, zn

Details for d4hwra1

PDB Entry: 4hwr (more details), 1.9 Å

PDB Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor
PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4hwra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hwra1 d.104.1.1 (A:242-532) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOPe Domain Coordinates for d4hwra1:

Click to download the PDB-style file with coordinates for d4hwra1.
(The format of our PDB-style files is described here.)

Timeline for d4hwra1: