Lineage for d4hwpb1 (4hwp B:242-532)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) Protein automated matches [193659] (7 species)
not a true protein
Species Escherichia coli K-12 [TaxId:83333] [227935] (6 PDB entries) 
Domain d4hwpb1: 4hwp B:242-532 [227936]
Other proteins in same PDB: d4hwpa2, d4hwpa3, d4hwpb2
automated match to d1qf6a4
protein/RNA complex; complexed with x16, zn
Details for d4hwpb1
PDB Entry: 4hwp (more details), 1.81 Å
PDB Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor
PDB Compounds: (B:) Threonine--tRNA ligaseSCOPe Domain Sequences for d4hwpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hwpb1 d.104.1.1 (B:242-532) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf
SCOPe Domain Coordinates for d4hwpb1:
Click to download the PDB-style file with coordinates for d4hwpb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hwpb1:
- d4hwpb1 first appeared in SCOPe 2.03
- d4hwpb1 appears in SCOPe 2.06
- d4hwpb1 appears in the current release, SCOPe 2.08
View in 3D
