![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Sepiapterin reductase [51767] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141874] (14 PDB entries) Uniprot P35270 5-261 |
![]() | Domain d4hwka_: 4hwk A: [252530] automated match to d1z6za1 complexed with gol, nap, peg, sfy, so4 |
PDB Entry: 4hwk (more details), 2.4 Å
SCOPe Domain Sequences for d4hwka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hwka_ c.2.1.2 (A:) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]} glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls llekdefksgahvdfyd
Timeline for d4hwka_: