Lineage for d4hw0a_ (4hw0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984628Species Sulfolobus solfataricus [TaxId:273057] [228633] (1 PDB entry)
  8. 1984629Domain d4hw0a_: 4hw0 A: [228634]
    automated match to d1r7ja_

Details for d4hw0a_

PDB Entry: 4hw0 (more details), 2 Å

PDB Description: crystal structure of sso10a-2, a dna-binding protein from sulfolobus solfataricus
PDB Compounds: (A:) DNA-binding protein Sso10a-2

SCOPe Domain Sequences for d4hw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hw0a_ a.4.5.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
krgtmeimfdilrncepkcgitrviygaginyvvaqkyldqlvkvgalniktendrkiye
itekgkllrthieefikirenlysakekvsellrtdse

SCOPe Domain Coordinates for d4hw0a_:

Click to download the PDB-style file with coordinates for d4hw0a_.
(The format of our PDB-style files is described here.)

Timeline for d4hw0a_: