Lineage for d4hv4a2 (4hv4 A:108-322)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2512449Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2512507Family c.72.2.0: automated matches [254328] (1 protein)
    not a true family
  6. 2512508Protein automated matches [254749] (4 species)
    not a true protein
  7. 2512542Species Yersinia pestis [TaxId:214092] [256291] (1 PDB entry)
  8. 2512543Domain d4hv4a2: 4hv4 A:108-322 [252519]
    Other proteins in same PDB: d4hv4a1, d4hv4a3, d4hv4b1, d4hv4b3
    automated match to d1p3da3
    complexed with amp, bme

Details for d4hv4a2

PDB Entry: 4hv4 (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of udp-n-acetylmuramate--l- alanine ligase (murc) from yersinia pestis co92 in complex with amp
PDB Compounds: (A:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d4hv4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hv4a2 c.72.2.0 (A:108-322) automated matches {Yersinia pestis [TaxId: 214092]}
raemlaelmryrhgiavagthgkttttamlssiyaeagldptfvngglvkaagtharlgs
sryliaeadesdasflhlqpmvaivtnieadhmdtyqgdfenlkqtfinflhnlpfygra
vmciddpvvrellprvgrhittygfsddadvqiasyrqegpqghftlrrqdkplievtln
apgrhnalnaaaavavateegiededilralvgfq

SCOPe Domain Coordinates for d4hv4a2:

Click to download the PDB-style file with coordinates for d4hv4a2.
(The format of our PDB-style files is described here.)

Timeline for d4hv4a2: