Lineage for d4hu7b_ (4hu7 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.1: Thioltransferase [52834] (16 proteins) 
Protein Thioredoxin [52835] (16 species) 
Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
Uniprot P00274 ! Uniprot P00581
Domain d4hu7b_: 4hu7 B: [197184]
automated match to d2trxa_
complexed with cu, na
Details for d4hu7b_
PDB Entry: 4hu7 (more details), 1.4 Å
PDB Description: e. coli thioredoxin variant with pro76 as single proline residue
PDB Compounds: (B:) Thioredoxin-1SCOPe Domain Sequences for d4hu7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hu7b_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
iihltddsfdtdvlkadgailvdfwaewcgackmiaaildeiadeyqgkltvaklnidqn
agtaakygirgiptlllfkngevaatkvgalskgqlkefldanl
SCOPe Domain Coordinates for d4hu7b_:
Click to download the PDB-style file with coordinates for d4hu7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hu7b_:
- d4hu7b_ first appeared in SCOPe 2.02
- d4hu7b_ appears in SCOPe 2.07
View in 3D
