Lineage for d4hszc_ (4hsz C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733398Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1733399Protein Calcyclin (S100) [47479] (17 species)
  7. 1733492Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (8 PDB entries)
    MTS1 protein
  8. 1733519Domain d4hszc_: 4hsz C: [194055]
    automated match to d1m31a_
    complexed with ca

Details for d4hszc_

PDB Entry: 4hsz (more details), 2.25 Å

PDB Description: Structure of truncated (delta8C) S100A4
PDB Compounds: (C:) Protein S100-A4

SCOPe Domain Sequences for d4hszc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hszc_ a.39.1.2 (C:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
cplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnl
dsnrdnevdfqeycvflsciammcneffeg

SCOPe Domain Coordinates for d4hszc_:

Click to download the PDB-style file with coordinates for d4hszc_.
(The format of our PDB-style files is described here.)

Timeline for d4hszc_: