Lineage for d4hrxa_ (4hrx A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (104 species)
    not a true protein
  7. 2477329Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (14 PDB entries)
  8. 2477338Domain d4hrxa_: 4hrx A: [252492]
    automated match to d1woma_

Details for d4hrxa_

PDB Entry: 4hrx (more details), 2.11 Å

PDB Description: Crystal structure of KAI2
PDB Compounds: (A:) Hydrolase, alpha/beta fold family protein

SCOPe Domain Sequences for d4hrxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hrxa_ c.69.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdyf
dfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisasp
ryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnmr
pdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevip
sdghlpqlsspdsvipvilrhirndi

SCOPe Domain Coordinates for d4hrxa_:

Click to download the PDB-style file with coordinates for d4hrxa_.
(The format of our PDB-style files is described here.)

Timeline for d4hrxa_: