Lineage for d4hr2b_ (4hr2 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951451Species Burkholderia thailandensis [TaxId:271848] [193397] (3 PDB entries)
  8. 2951453Domain d4hr2b_: 4hr2 B: [193398]
    Other proteins in same PDB: d4hr2a2
    automated match to d3pj9d_
    complexed with adp

Details for d4hr2b_

PDB Entry: 4hr2 (more details), 1.95 Å

PDB Description: Structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis bound to ADP
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4hr2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hr2b_ d.58.6.1 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
alertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhaerpffk
dlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgsda
petarveiafffpemnvysr

SCOPe Domain Coordinates for d4hr2b_:

Click to download the PDB-style file with coordinates for d4hr2b_.
(The format of our PDB-style files is described here.)

Timeline for d4hr2b_: