Lineage for d4hoja2 (4hoj A:79-201)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714114Species Neisseria gonorrhoeae [TaxId:485] [234685] (1 PDB entry)
  8. 2714115Domain d4hoja2: 4hoj A:79-201 [234686]
    Other proteins in same PDB: d4hoja1
    automated match to d3fhsa2
    complexed with act, ca, gsh

Details for d4hoja2

PDB Entry: 4hoj (more details), 1.4 Å

PDB Description: Crystal structure of glutathione transferase homolog from Neisseria Gonorrhoeae, target EFI-501841, with bound glutathione
PDB Compounds: (A:) RegF protein

SCOPe Domain Sequences for d4hoja2:

Sequence, based on SEQRES records: (download)

>d4hoja2 a.45.1.0 (A:79-201) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
lmpgdpvmrgrgrlvlyrmekelfnhvqvlenpaaankeqakareaigngltmlspsfsk
skyilgedfsmidvalapllwrldhydvklgksaapllkyaerifqreafiealtpaeka
mrk

Sequence, based on observed residues (ATOM records): (download)

>d4hoja2 a.45.1.0 (A:79-201) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
lmpgdpvmrgrgrlvlyrmekelfnhvqvlenpaaankeqakareaigngltmlspssky
ilgedfsmidvalapllwrldhydvklgksaapllkyaerifqreafiealtpaekamrk

SCOPe Domain Coordinates for d4hoja2:

Click to download the PDB-style file with coordinates for d4hoja2.
(The format of our PDB-style files is described here.)

Timeline for d4hoja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hoja1