Lineage for d4hoja2 (4hoj A:79-201)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domainFamily a.45.1.0: automated matches [227130] (1 protein)
not a true familyProtein automated matches [226831] (73 species)
not a true protein
Species Neisseria gonorrhoeae [TaxId:485] [234685] (1 PDB entry) 
Domain d4hoja2: 4hoj A:79-201 [234686]
Other proteins in same PDB: d4hoja1
automated match to d3fhsa2
complexed with act, ca, gsh
Details for d4hoja2
PDB Entry: 4hoj (more details), 1.4 Å
PDB Description: Crystal structure of glutathione transferase homolog from Neisseria Gonorrhoeae, target EFI-501841, with bound glutathione
PDB Compounds: (A:) RegF proteinSCOPe Domain Sequences for d4hoja2:
Sequence, based on SEQRES records: (download)
>d4hoja2 a.45.1.0 (A:79-201) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
lmpgdpvmrgrgrlvlyrmekelfnhvqvlenpaaankeqakareaigngltmlspsfsk
skyilgedfsmidvalapllwrldhydvklgksaapllkyaerifqreafiealtpaeka
mrk
Sequence, based on observed residues (ATOM records): (download)
>d4hoja2 a.45.1.0 (A:79-201) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
lmpgdpvmrgrgrlvlyrmekelfnhvqvlenpaaankeqakareaigngltmlspssky
ilgedfsmidvalapllwrldhydvklgksaapllkyaerifqreafiealtpaekamrk
SCOPe Domain Coordinates for d4hoja2:
Click to download the PDB-style file with coordinates for d4hoja2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hoja2:
- d4hoja2 first appeared in SCOPe 2.03
- d4hoja2 appears in SCOPe 2.07
View in 3D
