Lineage for d4hoja1 (4hoj A:2-78)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880057Species Neisseria gonorrhoeae [TaxId:485] [234683] (1 PDB entry)
  8. 2880058Domain d4hoja1: 4hoj A:2-78 [234684]
    Other proteins in same PDB: d4hoja2
    automated match to d3fhsa1
    complexed with act, ca, gsh

Details for d4hoja1

PDB Entry: 4hoj (more details), 1.4 Å

PDB Description: Crystal structure of glutathione transferase homolog from Neisseria Gonorrhoeae, target EFI-501841, with bound glutathione
PDB Compounds: (A:) RegF protein

SCOPe Domain Sequences for d4hoja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hoja1 c.47.1.0 (A:2-78) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
mtlysgitcpfshrcrfvlyekgmdfeikdidiynkpedlavmnpynqvpvlverdlvlh
esniineyiderfphpq

SCOPe Domain Coordinates for d4hoja1:

Click to download the PDB-style file with coordinates for d4hoja1.
(The format of our PDB-style files is described here.)

Timeline for d4hoja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hoja2