| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Neisseria gonorrhoeae [TaxId:485] [234683] (1 PDB entry) |
| Domain d4hoja1: 4hoj A:2-78 [234684] Other proteins in same PDB: d4hoja2 automated match to d3fhsa1 complexed with act, ca, gsh |
PDB Entry: 4hoj (more details), 1.4 Å
SCOPe Domain Sequences for d4hoja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hoja1 c.47.1.0 (A:2-78) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
mtlysgitcpfshrcrfvlyekgmdfeikdidiynkpedlavmnpynqvpvlverdlvlh
esniineyiderfphpq
Timeline for d4hoja1: