Lineage for d4hn0c_ (4hn0 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807602Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 1807603Protein automated matches [190388] (20 species)
    not a true protein
  7. 1807724Species Streptomyces bikiniensis [TaxId:1896] [193359] (3 PDB entries)
  8. 1807735Domain d4hn0c_: 4hn0 C: [194292]
    automated match to d2c0za1
    complexed with cl, edo

Details for d4hn0c_

PDB Entry: 4hn0 (more details), 2.2 Å

PDB Description: Crystal Structure of ChmJ, a 3'-monoepimerase apoenzyme from Streptomyces bikiniensis
PDB Compounds: (C:) Putative 3-epimerase in D-allose pathway

SCOPe Domain Sequences for d4hn0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hn0c_ b.82.1.0 (C:) automated matches {Streptomyces bikiniensis [TaxId: 1896]}
mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgih
yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
sltddatlvylcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
llptyqawqeqqqaqrle

SCOPe Domain Coordinates for d4hn0c_:

Click to download the PDB-style file with coordinates for d4hn0c_.
(The format of our PDB-style files is described here.)

Timeline for d4hn0c_: