Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (20 species) not a true protein |
Species Streptomyces bikiniensis [TaxId:1896] [193359] (3 PDB entries) |
Domain d4hn0c_: 4hn0 C: [194292] automated match to d2c0za1 complexed with cl, edo |
PDB Entry: 4hn0 (more details), 2.2 Å
SCOPe Domain Sequences for d4hn0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hn0c_ b.82.1.0 (C:) automated matches {Streptomyces bikiniensis [TaxId: 1896]} mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgih yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl sltddatlvylcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg llptyqawqeqqqaqrle
Timeline for d4hn0c_: