Lineage for d4hmmb_ (4hmm B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928689Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2928690Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2928691Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2928755Protein automated matches [191016] (9 species)
    not a true protein
  7. 2928798Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries)
  8. 2928802Domain d4hmmb_: 4hmm B: [222674]
    automated match to d1fo7a_
    complexed with cl, gol, na; mutant

Details for d4hmmb_

PDB Entry: 4hmm (more details), 1.5 Å

PDB Description: Crystal structure of mutant rabbit PRP 121-230 (S174N)
PDB Compounds: (B:) major prion protein

SCOPe Domain Sequences for d4hmmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hmmb_ d.6.1.1 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqesqaayqraa

SCOPe Domain Coordinates for d4hmmb_:

Click to download the PDB-style file with coordinates for d4hmmb_.
(The format of our PDB-style files is described here.)

Timeline for d4hmmb_: