Lineage for d4hmka_ (4hmk A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256405Fold f.54: SNF-like [161069] (1 superfamily)
    12 transmembrane helices; duplication: consists of two structurally similar halves
  4. 2256406Superfamily f.54.1: SNF-like [161070] (1 family) (S)
  5. 2256407Family f.54.1.1: SNF-like [161071] (2 proteins)
    Pfam PF00209; Sodium:neurotransmitter symporter
  6. 2256408Protein Na(+):neurotransmitter symporter homologue LeuT [161072] (1 species)
  7. 2256409Species Aquifex aeolicus [TaxId:63363] [161073] (38 PDB entries)
    Uniprot O67854 5-513
  8. 2256438Domain d4hmka_: 4hmk A: [252467]
    automated match to d2q6ha_
    complexed with bog, br, leu, na

Details for d4hmka_

PDB Entry: 4hmk (more details), 3 Å

PDB Description: crystal structure of leut-e290s with bound br
PDB Compounds: (A:) Transporter

SCOPe Domain Sequences for d4hmka_:

Sequence, based on SEQRES records: (download)

>d4hmka_ f.54.1.1 (A:) Na(+):neurotransmitter symporter homologue LeuT {Aquifex aeolicus [TaxId: 63363]}
krehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiew
amgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikfl
vglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsil
irgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgv
wiaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekasvilggsisipaav
affgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpm
iafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliif
fwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtv
witrfyiiglflfltflvflaerrrnhes

Sequence, based on observed residues (ATOM records): (download)

>d4hmka_ f.54.1.1 (A:) Na(+):neurotransmitter symporter homologue LeuT {Aquifex aeolicus [TaxId: 63363]}
krehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiew
amgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikfl
vglvpepptdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirg
iskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwia
avgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekasvilggsisipaavaff
gvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmiaf
ledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwi
fgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyeethwtvwitrfyii
glflfltflvflaerrrnhes

SCOPe Domain Coordinates for d4hmka_:

Click to download the PDB-style file with coordinates for d4hmka_.
(The format of our PDB-style files is described here.)

Timeline for d4hmka_: