Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
Protein automated matches [226879] (8 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [226021] (2 PDB entries) |
Domain d4hl7b2: 4hl7 B:151-426 [252462] Other proteins in same PDB: d4hl7a1, d4hl7a3, d4hl7b1, d4hl7b3 automated match to d3os4a2 complexed with so4 |
PDB Entry: 4hl7 (more details), 1.8 Å
SCOPe Domain Sequences for d4hl7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hl7b2 c.1.17.0 (B:151-426) automated matches {Vibrio cholerae [TaxId: 243277]} vpadlplkvlktkldqlkaeierrginnfsltemgtrrrfssqvqrdvlaclkqeipqwv lgtsnyhfarefdlkpigtiahewfmghqalvnerdsqqvalerwltafdgmlaiaptdt ltidaflndfnrhlanaydgvrhdsgcpfrwgdkmiahyqqlgidpttklfifsdgldfd qalelceyfagrvkisfgigtfltndlanwrnaagveyrplsiviklaecqgrpvakisd qpekamcedpiflanlkrrfnieldvdaliqelrhq
Timeline for d4hl7b2: