Lineage for d4hjgh_ (4hjg H:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261719Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1261720Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 1261721Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1261741Protein automated matches [191290] (2 species)
    not a true protein
  7. 1261745Species Staphylococcus aureus [TaxId:158878] [228180] (3 PDB entries)
  8. 1261746Domain d4hjgh_: 4hjg H: [228181]
    Other proteins in same PDB: d4hjga1, d4hjga2, d4hjge_
    automated match to d1h0ta_

Details for d4hjgh_

PDB Entry: 4hjg (more details), 2 Å

PDB Description: Meditope-enabled trastuzumab
PDB Compounds: (H:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4hjgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hjgh_ a.8.1.1 (H:) automated matches {Staphylococcus aureus [TaxId: 158878]}
gsynkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

SCOPe Domain Coordinates for d4hjgh_:

Click to download the PDB-style file with coordinates for d4hjgh_.
(The format of our PDB-style files is described here.)

Timeline for d4hjgh_: