SCOPe 2.06: Domain d4hhyd1: 4hhy D:4-135

Lineage for d4hhyd1 (4hhy D:4-135)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)
Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
core: 4 helices: bundle; unusual topology
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
duplication: consists of 2 helix-loop-helix structural repeats
automatically mapped to Pfam PF02877
Family a.41.1.0: automated matches [227223] (1 protein)
not a true family
Protein automated matches [226964] (1 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225405] (44 PDB entries)
Domain d4hhyd1: 4hhy D:4-135 [222608]
Other proteins in same PDB: d4hhya2, d4hhyb2, d4hhyc2, d4hhyd2
automated match to d1gs0a1
complexed with 15r, peg, so4

Details for d4hhyd1

PDB Entry: 4hhy (more details), 2.36 Å

PDB Description: Crystal structure of PARP catalytic domain in complex with novel inhibitors

PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4hhyd1:

Sequence, based on SEQRES records: (download)

>d4hhyd1 a.41.1.0 (D:4-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsqgs
sdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggsdd
sskdpidvnyek

Sequence, based on observed residues (ATOM records): (download)

>d4hhyd1 a.41.1.0 (D:4-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkpvqdlikmifdvkamvedlqgklskrqiqaaysilsevqqavsqgssdsqildlsnr
fytliphdnnadsvqakaemldnlldievayslpidvnyek

SCOPe Domain Coordinates for d4hhyd1:

Click to download the PDB-style file with coordinates for d4hhyd1.
(The format of our PDB-style files is described here.)

Timeline for d4hhyd1: