![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
![]() | Protein automated matches [190066] (7 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [193409] (2 PDB entries) |
![]() | Domain d4hhht_: 4hhh T: [193410] Other proteins in same PDB: d4hhha1, d4hhha2, d4hhhb1, d4hhhb2, d4hhhc1, d4hhhc2, d4hhhd1, d4hhhd2 automated match to d3rubs_ complexed with rub |
PDB Entry: 4hhh (more details), 2.2 Å
SCOPe Domain Sequences for d4hhht_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hhht_ d.73.1.1 (T:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg yydgrywtmwklpmfgttdpaqvlkeldevkkeyprafvrvigfnnvrqvqcisfiahtp esy
Timeline for d4hhht_: