Lineage for d4hf4a_ (4hf4 A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) 
Family a.211.1.0: automated matches [191566] (1 protein)
not a true familyProtein automated matches [190983] (10 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries) 
Domain d4hf4a_: 4hf4 A: [252422]
automated match to d4heua_
complexed with 15h, gol, so4, zn
Details for d4hf4a_
PDB Entry: 4hf4 (more details), 2 Å
PDB Description: Crystal Structure of PDE10A with a biaryl ether inhibitor (1-(1-(3-(4-(benzo[d]thiazol-2-ylamino)phenoxy)pyrazin-2-yl)piperidin-4-yl)ethanol)
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10ASCOPe Domain Sequences for d4hf4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hf4a_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
lkacrdnlsqwekvirge
SCOPe Domain Coordinates for d4hf4a_:
Click to download the PDB-style file with coordinates for d4hf4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hf4a_:
- d4hf4a_ first appeared in SCOPe 2.04
- d4hf4a_ appears in SCOPe 2.06
- d4hf4a_ appears in the current release, SCOPe 2.08
View in 3D
