Lineage for d4heia_ (4hei A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the restSuperfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) 
automatically mapped to Pfam PF02482Family d.204.1.0: automated matches [227270] (1 protein)
not a true familyProtein automated matches [227070] (5 species)
not a true proteinSpecies Vibrio cholerae [TaxId:243277] [226508] (1 PDB entry) 
Domain d4heia_: 4hei A: [222553]
automated match to d2ywqa1
complexed with 3co, scn, unl
Details for d4heia_
PDB Entry: 4hei (more details), 1.6 Å
PDB Description: 2a x-ray structure of hpf from vibrio cholerae
PDB Compounds: (A:) Ribosome hibernation protein YhbHSCOPe Domain Sequences for d4heia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4heia_ d.204.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mqiniqghhidltdsmqdyvhskfdklerffdhinhvqvilrveklrqiaeatlhvnqae
ihahaddenmyaaidslvdklvrqlnkhkekl
SCOPe Domain Coordinates for d4heia_:
Click to download the PDB-style file with coordinates for d4heia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4heia_:
- d4heia_ first appeared in SCOPe 2.03
- d4heia_ appears in SCOPe 2.05
- d4heia_ appears in SCOPe 2.07
- d4heia_ appears in the current release, SCOPe 2.08
View in 3D
