Lineage for d4heia_ (4hei A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944234Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 1944235Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) (S)
    automatically mapped to Pfam PF02482
  5. 1944252Family d.204.1.0: automated matches [227270] (1 protein)
    not a true family
  6. 1944253Protein automated matches [227070] (4 species)
    not a true protein
  7. 1944264Species Vibrio cholerae [TaxId:243277] [226508] (1 PDB entry)
  8. 1944265Domain d4heia_: 4hei A: [222553]
    automated match to d2ywqa1
    complexed with 3co, scn, unl

Details for d4heia_

PDB Entry: 4hei (more details), 1.6 Å

PDB Description: 2a x-ray structure of hpf from vibrio cholerae
PDB Compounds: (A:) Ribosome hibernation protein YhbH

SCOPe Domain Sequences for d4heia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4heia_ d.204.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mqiniqghhidltdsmqdyvhskfdklerffdhinhvqvilrveklrqiaeatlhvnqae
ihahaddenmyaaidslvdklvrqlnkhkekl

SCOPe Domain Coordinates for d4heia_:

Click to download the PDB-style file with coordinates for d4heia_.
(The format of our PDB-style files is described here.)

Timeline for d4heia_: